PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.AVV74
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 330aa    MW: 38084.7 Da    PI: 6.0153
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.AVV74genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.8e-54191461129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lp GfrFhPtd el+++yL kkv ++k+ ++ +i+++d++k+ePwdLp  +k +e+ewyfFs +d+ky+tg+r+nrat++gyWkatgkdke+ + +++
  Araip.AVV74  19 LPSGFRFHPTDVELINYYLVKKVLDDKHFCSIAIADADMNKSEPWDLPGLAKMGETEWYFFSMKDRKYPTGQRTNRATEAGYWKATGKDKEISK-ENS 115
                  699************************888888***************8888899*************************************99.889 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  ++g+kktLvfykgrap+gekt+Wvmheyrle
  Araip.AVV74 116 KIGMKKTLVFYKGRAPRGEKTNWVMHEYRLE 146
                  9****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6015170IPR003441NAC domain
PROSITE profilePS5100558.48619170IPR003441NAC domain
PfamPF023652.0E-2820145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MESMENVRMQ REKDQKFELP SGFRFHPTDV ELINYYLVKK VLDDKHFCSI AIADADMNKS  60
EPWDLPGLAK MGETEWYFFS MKDRKYPTGQ RTNRATEAGY WKATGKDKEI SKENSKIGMK  120
KTLVFYKGRA PRGEKTNWVM HEYRLEGNKS VYNLSQPERG EWVICRVFEK GNHGKRLNIA  180
KLERLNSLGE EPLPLPKPTP LMPPLMDSSS SRTTPGELSQ ATCYSSDPNQ AEVRNNLHDD  240
IVESRETPIL NFSPASINEE FFQIPNQIEK PDCYTPPQEN NGSIARQNQK SEFDADISSL  300
IYNNDMFYRF FGNQEHSSSA SADICNLWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5091723170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016196797.10.0PREDICTED: NAC domain-containing protein 92-like
TrEMBLA0A0B2PRD21e-139A0A0B2PRD2_GLYSO; NAC domain-containing protein 100
TrEMBLI1L5V31e-139I1L5V3_SOYBN; Uncharacterized protein
STRINGGLYMA09G37050.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.17e-86NAC domain containing protein 100